Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vps25 Peptide - C-terminal region

Vps25 Peptide - C-terminal region

Product Specifications

UniProt

P0C0A1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vps25 Rabbit Polyclonal Antibody (orb331100) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001166922

Preservative

Lyophilized powder

AA Sequence

LYELTSGEDTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Matrix Gla protein (MGP) ELISA Kit
EK9609 48 Tests

Rabbit Matrix Gla protein (MGP) ELISA Kit

Sign In for Pricing
View Details
Mfhas1 AAV siRNA Pooled Vector
28442164 1.0 µg

Mfhas1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Ganciclovir
32-3870-500 500 mg

Ganciclovir

Sign In for Pricing
View Details
MS4A13 (NM_001012417) Human Over-expression Lysate
LS503497 100 µg

MS4A13 (NM_001012417) Human Over-expression Lysate

Sign In for Pricing
View Details
ENO1 Mouse
32-6736-10 10 µg

ENO1 Mouse

Sign In for Pricing
View Details
IFNGR2 antibody
FNab04150 100 µg

IFNGR2 antibody

Sign In for Pricing
View Details