Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vps25 Peptide - C-terminal region

Vps25 Peptide - C-terminal region

Product Specifications

UniProt

P0C0A1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vps25 Rabbit Polyclonal Antibody (orb331100) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001166922

Preservative

Lyophilized powder

AA Sequence

LYELTSGEDTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NK2 Homeobox 5 (NKX2-5) Antibody
abx235751 100 µg

NK2 Homeobox 5 (NKX2-5) Antibody

Sign In for Pricing
View Details
PPP1R3E Antibody
E51A14818 100 µL

PPP1R3E Antibody

Sign In for Pricing
View Details
Human CLINT1 protein
orb358882-01 20 µg

Human CLINT1 protein

Sign In for Pricing
View Details
Human CLINT1 protein
orb358882-02 100 µg

Human CLINT1 protein

Sign In for Pricing
View Details
Human CLINT1 protein
orb358882-03 1 mg

Human CLINT1 protein

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C18B5.09c (SPCC18B5.09c)
MBS1369301-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C18B5.09c (SPCC18B5.09c)

Sign In for Pricing
View Details