Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Il20rb Peptide - middle region

Il20rb Peptide - middle region

Product Specifications

Product Name Alternative

AV228068, Fndc6, Gm186, Il20R2

UniProt

E9Q9A6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Il20rb Rabbit Polyclonal Antibody (orb584777) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028715

Preservative

Lyophilized powder

AA Sequence

LEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP27 (HAUS2) Rabbit Polyclonal Antibody
TA372224 100 µL

CEP27 (HAUS2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PETROLEUM450X52CARD-T1-P18 Pipe Markers for Other Liquids
N005340 2 Card (2 Marker (s) x 1 Card)

PETROLEUM450X52CARD-T1-P18 Pipe Markers for Other Liquids

Sign In for Pricing
View Details
RNF135 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-11753R-BF488 100 µL

RNF135 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
TMPRSS4 Antibody
MBS9603265-01 0.1 mL

TMPRSS4 Antibody

Sign In for Pricing
View Details
TMPRSS4 Antibody
MBS9603265-02 0.2 mL

TMPRSS4 Antibody

Sign In for Pricing
View Details
TMPRSS4 Antibody
MBS9603265-03 5x 0.2 mL

TMPRSS4 Antibody

Sign In for Pricing
View Details