Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Il20rb Peptide - middle region

Il20rb Peptide - middle region

Product Specifications

Product Name Alternative

AV228068, Fndc6, Gm186, Il20R2

UniProt

E9Q9A6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Il20rb Rabbit Polyclonal Antibody (orb584777) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028715

Preservative

Lyophilized powder

AA Sequence

LEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB2 Rabbit pAb
E45R21853N 50 ul

SERPINB2 Rabbit pAb

Sign In for Pricing
View Details
NrCAM Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61527R-BF555-01 20 µL

NrCAM Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
NrCAM Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61527R-BF555-02 100 µL

NrCAM Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Active Recombinant Cynomolgus PDCD1LG2, Fc tagged
PDCD1LG2-128C 100 µg

Active Recombinant Cynomolgus PDCD1LG2, Fc tagged

Sign In for Pricing
View Details
HT-29
ABC-TC0428 1 Vial

HT-29

Sign In for Pricing
View Details
Mouse Thrombospondin-2 (Thbs2) Elisa Kit
EKC42664 96 Tests

Mouse Thrombospondin-2 (Thbs2) Elisa Kit

Sign In for Pricing
View Details