Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tfap2b Peptide - N-terminal region

Tfap2b Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tcfap2b

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tfap2b Rabbit Polyclonal Antibody (orb584992) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100366

Preservative

Lyophilized powder

AA Sequence

HPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAD3 Recombinant Rabbit Monoclonal Antibody [JE48-14]
ET7109-76 100 µL

MAD3 Recombinant Rabbit Monoclonal Antibody [JE48-14]

Sign In for Pricing
View Details
Olaquindox
TRC-O515000-10MG 10 mg

Olaquindox

Sign In for Pricing
View Details
Isophorone Diamine(cis/trans Mixture)
TRC-I821935-1G 1 g

Isophorone Diamine(cis/trans Mixture)

Sign In for Pricing
View Details
CCR5 Human Gene Knockout Kit (CRISPR)
KN216008BN 1 Kit

CCR5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MRP L9 (MRPL9) activation kit by CRISPRa
GA112217 1 Kit

Human MRP L9 (MRPL9) activation kit by CRISPRa

Sign In for Pricing
View Details
RHBDL1 Human Gene Knockout Kit (CRISPR)
KN421768 1 Kit

RHBDL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details