Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tfap2b Peptide - N-terminal region

Tfap2b Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tcfap2b

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tfap2b Rabbit Polyclonal Antibody (orb584992) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100366

Preservative

Lyophilized powder

AA Sequence

HPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMF Mouse Monoclonal Antibody [Clone ID: OTI6F3]
CF807459 100 µg

BMF Mouse Monoclonal Antibody [Clone ID: OTI6F3]

Sign In for Pricing
View Details
CCDC140 Human qPCR Primer Pair (NM_153038)
HP218036 200 Reactions

CCDC140 Human qPCR Primer Pair (NM_153038)

Sign In for Pricing
View Details
HRP Conjugated Sophora japonica (Pagoda Tree) -SJA-
H-2901-1 1 mg

HRP Conjugated Sophora japonica (Pagoda Tree) -SJA-

Sign In for Pricing
View Details
Ent-Olutasidenib
TRC-O299820-100MG 100 mg

Ent-Olutasidenib

Sign In for Pricing
View Details
Angiotensin II Type 1 Receptor (AGTR1) Human Gene Knockout Kit (CRISPR)
KN205162 1 Kit

Angiotensin II Type 1 Receptor (AGTR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CF®488A Methyltetrazine
#96028 1x 1 mg

CF®488A Methyltetrazine

Sign In for Pricing
View Details