Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Git1 Peptide - middle region

Git1 Peptide - middle region

Product Specifications

UniProt

Q9Z272

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Git1 Rabbit Polyclonal Antibody (orb585025) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114002

Preservative

Lyophilized powder

AA Sequence

PLLSSSQEGSRHASKLSRHGSGAESDYENTQSGEPLLGLEGKRFLELSKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chiniofon
T9549 2 g

Chiniofon

Sign In for Pricing
View Details
Canine Actin Gamma 2, Smooth Muscle ELISA Kit
MBS096682-01 48 Well

Canine Actin Gamma 2, Smooth Muscle ELISA Kit

Sign In for Pricing
View Details
Canine Actin Gamma 2, Smooth Muscle ELISA Kit
MBS096682-02 96 Well

Canine Actin Gamma 2, Smooth Muscle ELISA Kit

Sign In for Pricing
View Details
Canine Actin Gamma 2, Smooth Muscle ELISA Kit
MBS096682-03 5x 96 Well

Canine Actin Gamma 2, Smooth Muscle ELISA Kit

Sign In for Pricing
View Details
Canine Actin Gamma 2, Smooth Muscle ELISA Kit
MBS096682-04 10x 96 Well

Canine Actin Gamma 2, Smooth Muscle ELISA Kit

Sign In for Pricing
View Details
Epoxide hydrolase 1
315054-01 50 µg

Epoxide hydrolase 1

Sign In for Pricing
View Details