Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2f6 Peptide - middle region

E2f6 Peptide - middle region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with E2f6 Rabbit Polyclonal Antibody (orb585048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094187

Preservative

Lyophilized powder

AA Sequence

RRVYDITNVLDGIELVEKKSKNHIRWIGSDLNNFGAAPQQKKLQAELSDL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Caspase 9 (CASP9)
TRV-0039333-01 10 µg

Recombinant Caspase 9 (CASP9)

Sign In for Pricing
View Details
Recombinant Caspase 9 (CASP9)
TRV-0039333-02 50 µg

Recombinant Caspase 9 (CASP9)

Sign In for Pricing
View Details
Recombinant Caspase 9 (CASP9)
TRV-0039333-03 100 µg

Recombinant Caspase 9 (CASP9)

Sign In for Pricing
View Details
Recombinant Caspase 9 (CASP9)
TRV-0039333-04 200 µg

Recombinant Caspase 9 (CASP9)

Sign In for Pricing
View Details
Recombinant Caspase 9 (CASP9)
TRV-0039333-05 500 µg

Recombinant Caspase 9 (CASP9)

Sign In for Pricing
View Details
Recombinant Caspase 9 (CASP9)
TRV-0039333-06 1 mg

Recombinant Caspase 9 (CASP9)

Sign In for Pricing
View Details