E2f6 Peptide - middle region
E2f6 Peptide - middle region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with E2f6 Rabbit Polyclonal Antibody (orb585048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001094187
Preservative
Lyophilized powder
AA Sequence
RRVYDITNVLDGIELVEKKSKNHIRWIGSDLNNFGAAPQQKKLQAELSDL
More Discoveries
Explore Other Products
Browse additional items from our catalog
K7165807 1.0 µg DNA
Olr892 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details NBP2-54337AF594 0.1 mL
Mouse Monoclonal BRCA1 Antibody (BRCA1/1472) [Alexa Fluor 594]
Sign In for Pricing
View Details 
OR1026128 1 Each
(1S, 2S) -1,2-Bis (2-Chlorophenyl) -1,2-Ethanediamine Dihydrochloride
Sign In for Pricing
View Details