Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rela Peptide - middle region

Rela Peptide - middle region

Product Specifications

Product Name Alternative

NFkB

UniProt

Q7TQN4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rela Rabbit Polyclonal Antibody (orb585096) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_954888

Preservative

Lyophilized powder

AA Sequence

SMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F3 Antibody
orb357852-01 50 µg

F3 Antibody

Sign In for Pricing
View Details
F3 Antibody
orb357852-02 100 µg

F3 Antibody

Sign In for Pricing
View Details
Anti-Human CCL7/MCP-3 Antibody (SAA0539), PerCP
HX155147-01 1 Each

Anti-Human CCL7/MCP-3 Antibody (SAA0539), PerCP

Sign In for Pricing
View Details
Anti-Human CCL7/MCP-3 Antibody (SAA0539), PerCP
HX155147-02 100 Tests

Anti-Human CCL7/MCP-3 Antibody (SAA0539), PerCP

Sign In for Pricing
View Details
Monkey tRNA-specific adenosine deaminase 1 (ADAT1) ELISA Kit
MBS7200225-01 48 Well

Monkey tRNA-specific adenosine deaminase 1 (ADAT1) ELISA Kit

Sign In for Pricing
View Details
Monkey tRNA-specific adenosine deaminase 1 (ADAT1) ELISA Kit
MBS7200225-02 96 Well

Monkey tRNA-specific adenosine deaminase 1 (ADAT1) ELISA Kit

Sign In for Pricing
View Details