Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Igbp1b Peptide - middle region

Igbp1b Peptide - middle region

Product Specifications

Product Name Alternative

RGD1560971

UniProt

D3ZMB4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Igbp1b Rabbit Polyclonal Antibody (orb326401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102825

Preservative

Lyophilized powder

AA Sequence

LVAMASQRQAKIQRYKQKKAVEQRLSSLKSAVESGEADDERVREYYLLQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3496), CF405S conjugate, 0.1mg/mL
BNC043496-500 1x 500 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3496), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1149), Biotin conjugate, 0.1mg/mL
BNCB1149-100 1x 100 µL

CD71 (TFRC/1149), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
7-APB Hydrochloride
TRC-A790450-5MG 5 mg

7-APB Hydrochloride

Sign In for Pricing
View Details
Retnla Mouse Gene Knockout Kit (CRISPR)
KN514678 1 Kit

Retnla Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SAP30L (NM_001131063) Human Over-expression Lysate
LC427373 20 µg

SAP30L (NM_001131063) Human Over-expression Lysate

Sign In for Pricing
View Details
Low Temperature Circulator BCLT-2604
BCLT-2604 1 Unit

Low Temperature Circulator BCLT-2604

Sign In for Pricing
View Details