Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Igbp1b Peptide - middle region

Igbp1b Peptide - middle region

Product Specifications

Product Name Alternative

RGD1560971

UniProt

D3ZMB4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Igbp1b Rabbit Polyclonal Antibody (orb326401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102825

Preservative

Lyophilized powder

AA Sequence

LVAMASQRQAKIQRYKQKKAVEQRLSSLKSAVESGEADDERVREYYLLQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromo-6-chlorobenzoic Acid
TRC-B682535-2.5G 2.5 g

2-Bromo-6-chlorobenzoic Acid

Sign In for Pricing
View Details
(E)-3-(3-(4-Fluorophenyl)-1-isopropyl-1H-indol-2-yl)acrylaldehyde
TRC-F595670-2G 2 g

(E)-3-(3-(4-Fluorophenyl)-1-isopropyl-1H-indol-2-yl)acrylaldehyde

Sign In for Pricing
View Details
Ccp110 Mouse Gene Knockout Kit (CRISPR)
KN502830 1 Kit

Ccp110 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ADAM32 activation kit by CRISPRa
GA116433 1 Kit

Human ADAM32 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit IgG (Fcγ Fragment specific), AlpSdAbs® VHH (HRP)
HA710053 100 µg

Rabbit IgG (Fcγ Fragment specific), AlpSdAbs® VHH (HRP)

Sign In for Pricing
View Details
SLPI (NM_003064) Human Over-expression Lysate
LY418925 100 µg

SLPI (NM_003064) Human Over-expression Lysate

Sign In for Pricing
View Details