Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FERMT2 Peptide - C-terminal region

FERMT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIND2, MIG2, PLEKHC1, UNC112, UNC112B, mig-2

UniProt

Q96AC1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FERMT2 Rabbit Polyclonal Antibody (orb587009) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006823

Preservative

Lyophilized powder

AA Sequence

TSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calreticulin (CALR) Mouse Monoclonal Antibody [Clone ID: OTI13H4]
CF813231 100 µg

Calreticulin (CALR) Mouse Monoclonal Antibody [Clone ID: OTI13H4]

Sign In for Pricing
View Details
Actr10 Mouse Gene Knockout Kit (CRISPR)
KN500788 1 Kit

Actr10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DSCR1 Polyclonal Antibody
E-AB-16188-01 20 µL

DSCR1 Polyclonal Antibody

Sign In for Pricing
View Details
DSCR1 Polyclonal Antibody
E-AB-16188-02 60 µL

DSCR1 Polyclonal Antibody

Sign In for Pricing
View Details
DSCR1 Polyclonal Antibody
E-AB-16188-03 120 µL

DSCR1 Polyclonal Antibody

Sign In for Pricing
View Details
DSCR1 Polyclonal Antibody
E-AB-16188-04 200 µL

DSCR1 Polyclonal Antibody

Sign In for Pricing
View Details