FERMT2 Peptide - C-terminal region
FERMT2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
KIND2, MIG2, PLEKHC1, UNC112, UNC112B, mig-2
UniProt
Q96AC1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FERMT2 Rabbit Polyclonal Antibody (orb587009) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006823
Preservative
Lyophilized powder
AA Sequence
TSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDSM030 100 Assays
NADPH-Cytochrome c Reductase Microplate Assay Kit
Sign In for Pricing
View Details 
BNC682378-500 1x 500 µL
P21WAF1 (Tumor Suppressor Protein) (AC8), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC401350 20 µg
Synaptotagmin VII (SYT7) (NM_004200) Human Over-expression Lysate
Sign In for Pricing
View Details 
TRC-F625000-500MG 500 mg
N-Fmoc-D,L-Gamma-carboxyglutamic Acid Gamma,Gamma-Di-t-butyl Ester
Sign In for Pricing
View Details