Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL34 Peptide - N-terminal region

IL34 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C16orf77, IL-34

UniProt

Q6ZMJ4

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL34 Rabbit Polyclonal Antibody (orb587026) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001166242

Preservative

Lyophilized powder

AA Sequence

ALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Human CD5 Antibody[HISM2]
E-AB-F1313H-01 20 Tests

PE/Cyanine7 Anti-Human CD5 Antibody[HISM2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD5 Antibody[HISM2]
E-AB-F1313H-02 100 Tests

PE/Cyanine7 Anti-Human CD5 Antibody[HISM2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD5 Antibody[HISM2]
E-AB-F1313H-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD5 Antibody[HISM2]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS500047 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
TXNRD1 (NM_182729) Human Recombinant Protein
TP316045 20 µg

TXNRD1 (NM_182729) Human Recombinant Protein

Sign In for Pricing
View Details
(R)-Phenylephrine-d3 Hydrochloride
TRC-P320642-25MG 25 mg

(R)-Phenylephrine-d3 Hydrochloride

Sign In for Pricing
View Details