IL34 Peptide - N-terminal region
IL34 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C16orf77, IL-34
UniProt
Q6ZMJ4
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IL34 Rabbit Polyclonal Antibody (orb587026) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001166242
Preservative
Lyophilized powder
AA Sequence
ALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC400022 20 µg
p16INK4A (CDKN2A) (NM_000077) Human Over-expression Lysate
Sign In for Pricing
View Details ![GSK3 beta (GSK3B) (N-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 11B9]](https://cdn.genprice.uk/products/937/68dd1899061270361e8fb5f6/imageurl/am00066pu-n.webp)
AM00066PU-N 100 µg
GSK3 beta (GSK3B) (N-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 11B9]
Sign In for Pricing
View Details 
TRC-A603551-10MG 10 mg
1-Aminocyclopropane-2,2,3,3-d4-carboxylic Acid
Sign In for Pricing
View Details 
