Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHCYL2 Peptide - N-terminal region

AHCYL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ADOHCYASE3

UniProt

D9N155

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AHCYL2 Rabbit Polyclonal Antibody (orb587052) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001124195

Preservative

Lyophilized powder

AA Sequence

TDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Chloro-2-nitroanisole
TRC-C377695-25G 25 g

5-Chloro-2-nitroanisole

Sign In for Pricing
View Details
2-[(2-Chlorophenyl)amino]-3-nitrobenzoic Acid
TRC-C377628-2.5MG 2.5 mg

2-[(2-Chlorophenyl)amino]-3-nitrobenzoic Acid

Sign In for Pricing
View Details
Zinc 2-Mercaptobenzothiazole
TRC-Z701568-50G 50 g

Zinc 2-Mercaptobenzothiazole

Sign In for Pricing
View Details
Bace2 Mouse Gene Knockout Kit (CRISPR)
KN501951 1 Kit

Bace2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TOX3 activation kit by CRISPRa
GA109120 1 Kit

Human TOX3 activation kit by CRISPRa

Sign In for Pricing
View Details
IRX2 Human Gene Knockout Kit (CRISPR)
KN209142RB 1 Kit

IRX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details