Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUSD5 Peptide - middle region

SUSD5 Peptide - middle region

Product Specifications

UniProt

O60279

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUSD5 Rabbit Polyclonal Antibody (orb587054) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056366

Preservative

Lyophilized powder

AA Sequence

PGLEKEVDDDTKKQFSAGDNHSGVKLVPGEPETKVIYGNTDGPSGPFVGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMPDH2 (NM_000884) Human Over-expression Lysate
LY424469 100 µg

IMPDH2 (NM_000884) Human Over-expression Lysate

Sign In for Pricing
View Details
NAPRT1 (NAPRT) Rabbit Polyclonal Antibody
TA370550 100 µL

NAPRT1 (NAPRT) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PGRP1B (PGLYRP4) activation kit by CRISPRa
GA111381 1 Kit

Human PGRP1B (PGLYRP4) activation kit by CRISPRa

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF647 conjugate, 0.1mg/mL
BNC471461-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant IL-2 Receptor alpha Antibody
RC-3942-01 50 μL

Recombinant IL-2 Receptor alpha Antibody

Sign In for Pricing
View Details
Recombinant IL-2 Receptor alpha Antibody
RC-3942-02 100 µL

Recombinant IL-2 Receptor alpha Antibody

Sign In for Pricing
View Details