SUSD5 Peptide - middle region
SUSD5 Peptide - middle region
Product Specifications
UniProt
O60279
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SUSD5 Rabbit Polyclonal Antibody (orb587054) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_056366
Preservative
Lyophilized powder
AA Sequence
PGLEKEVDDDTKKQFSAGDNHSGVKLVPGEPETKVIYGNTDGPSGPFVGK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY427121 100 µg
SHC (SHC1) (NM_001130040) Human Over-expression Lysate
Sign In for Pricing
View Details ![AAV5 Rabbit Monoclonal Antibody [Clone ID: OTIR2F10]](https://cdn.genprice.uk/products/937/68dd1b74061270361ea1978e/imageurl/ta594352s.webp)
TA594352S 30 µL
AAV5 Rabbit Monoclonal Antibody [Clone ID: OTIR2F10]
Sign In for Pricing
View Details 
TP710406 20 µg
Desmoglein 1 (DSG1) (NM_001942) Human Recombinant Protein
Sign In for Pricing
View Details 
LY419657 100 µg
TRP2 (DCT) (NM_001922) Human Over-expression Lysate
Sign In for Pricing
View Details