Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDHD5 Peptide - C-terminal region

HDHD5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CECR5

UniProt

Q9BXW7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HDHD5 Rabbit Polyclonal Antibody (orb587059) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149061

Preservative

Lyophilized powder

AA Sequence

SQSCISILVCTGVYNPRNPQSTEPVLGGGEPPFHGHRDLCFSPGLMEASH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPI Polyclonal Antibody
E913308 100 µL

GPI Polyclonal Antibody

Sign In for Pricing
View Details
Dnali1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7190503 1.0 µg DNA

Dnali1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal ARHGAP11B Antibody [FITC]
NBP3-06142F 0.1 mL

Rabbit Polyclonal ARHGAP11B Antibody [FITC]

Sign In for Pricing
View Details
GSTM1 (NM_146421) Human Recombinant Protein
E45H31288E1 50 µg

GSTM1 (NM_146421) Human Recombinant Protein

Sign In for Pricing
View Details
CASC3 Conjugated Antibody
C36311 100 µL

CASC3 Conjugated Antibody

Sign In for Pricing
View Details
ATXN1L (NM_001137675) Human Tagged ORF Clone
RC227753 10 µg

ATXN1L (NM_001137675) Human Tagged ORF Clone

Sign In for Pricing
View Details