Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAS2R7 Peptide - middle region

TAS2R7 Peptide - middle region

Product Specifications

Product Name Alternative

T2R7, TRB4

UniProt

Q9NYW3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAS2R7 Rabbit Polyclonal Antibody (orb587063) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076408

Preservative

Lyophilized powder

AA Sequence

DFRFCVKAKRKTNLTWSCRVNKTQHASTKLFLNLATLLPFCVCLMSFFLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr48 (NM_001135895) Rat Tagged ORF Clone
RR204045 10 µg

Wdr48 (NM_001135895) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized oxidoreductase C16H5.14c (SPBC16H5.14c, SPBC21H7.08)
orb2927209-01 20 µg

Recombinant Schizosaccharomyces pombe Uncharacterized oxidoreductase C16H5.14c (SPBC16H5.14c, SPBC21H7.08)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized oxidoreductase C16H5.14c (SPBC16H5.14c, SPBC21H7.08)
orb2927209-02 100 µg

Recombinant Schizosaccharomyces pombe Uncharacterized oxidoreductase C16H5.14c (SPBC16H5.14c, SPBC21H7.08)

Sign In for Pricing
View Details
Human B3GNT2 qPCR Primer Pair
QH32157S 200 Tests

Human B3GNT2 qPCR Primer Pair

Sign In for Pricing
View Details
CD71 Antibody
MBS5316837-01 0.02 mg

CD71 Antibody

Sign In for Pricing
View Details
CD71 Antibody
MBS5316837-02 0.05 mg

CD71 Antibody

Sign In for Pricing
View Details