Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAS2R7 Peptide - middle region

TAS2R7 Peptide - middle region

Product Specifications

Product Name Alternative

T2R7, TRB4

UniProt

Q9NYW3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAS2R7 Rabbit Polyclonal Antibody (orb587063) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076408

Preservative

Lyophilized powder

AA Sequence

DFRFCVKAKRKTNLTWSCRVNKTQHASTKLFLNLATLLPFCVCLMSFFLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDIT4L Antibody (HRP)
orb46500-01 50 µg

DDIT4L Antibody (HRP)

Sign In for Pricing
View Details
DDIT4L Antibody (HRP)
orb46500-02 100 µg

DDIT4L Antibody (HRP)

Sign In for Pricing
View Details
LCE1B siRNA (h)
sc-78579 10 µM

LCE1B siRNA (h)

Sign In for Pricing
View Details
Monkey Heparanase 1 (HPA1) ELISA Kit
MBS9358125-01 48 Well

Monkey Heparanase 1 (HPA1) ELISA Kit

Sign In for Pricing
View Details
Monkey Heparanase 1 (HPA1) ELISA Kit
MBS9358125-02 96 Well

Monkey Heparanase 1 (HPA1) ELISA Kit

Sign In for Pricing
View Details
Monkey Heparanase 1 (HPA1) ELISA Kit
MBS9358125-03 5x 96 Well

Monkey Heparanase 1 (HPA1) ELISA Kit

Sign In for Pricing
View Details