Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMAC2 Peptide - C-terminal region

DMAC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATP5SL

UniProt

Q9NW81

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMAC2 Rabbit Polyclonal Antibody (orb587079) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060505

Preservative

Lyophilized powder

AA Sequence

ISDLPAVSNPGLTQILVEEMLPNCEVVGVDWAEGLKSGPEEQPRDTASPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDF15 Protein Vector (Human) (pPM-C-HA)
PV017415 500 ng

GDF15 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PCF11 (NM_015885) Human 3' UTR Clone
SC211094 10 µg

PCF11 (NM_015885) Human 3' UTR Clone

Sign In for Pricing
View Details
GPR83 Protein Vector (Human) (pPM-C-His)
PV018536 500 ng

GPR83 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
UBE2U (Ubiquitin-conjugating Enzyme E2 U, Ubiquitin Carrier Protein U, Ubiquitin-protein Ligase U, RP4-636O23.1) (Biotin)
MBS6145037-01 0.1 mL

UBE2U (Ubiquitin-conjugating Enzyme E2 U, Ubiquitin Carrier Protein U, Ubiquitin-protein Ligase U, RP4-636O23.1) (Biotin)

Sign In for Pricing
View Details
UBE2U (Ubiquitin-conjugating Enzyme E2 U, Ubiquitin Carrier Protein U, Ubiquitin-protein Ligase U, RP4-636O23.1) (Biotin)
MBS6145037-02 5x 0.1 mL

UBE2U (Ubiquitin-conjugating Enzyme E2 U, Ubiquitin Carrier Protein U, Ubiquitin-protein Ligase U, RP4-636O23.1) (Biotin)

Sign In for Pricing
View Details
Mouse Anti-Chicken c-Kit-BIOT
8380-08 0.5 mg

Mouse Anti-Chicken c-Kit-BIOT

Sign In for Pricing
View Details