Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMAC2 Peptide - C-terminal region

DMAC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATP5SL

UniProt

Q9NW81

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMAC2 Rabbit Polyclonal Antibody (orb587079) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060505

Preservative

Lyophilized powder

AA Sequence

ISDLPAVSNPGLTQILVEEMLPNCEVVGVDWAEGLKSGPEEQPRDTASPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FPR3 Human shRNA Lentiviral Particle (Locus ID 2359)
TL312925V 500 µL Each

FPR3 Human shRNA Lentiviral Particle (Locus ID 2359)

Sign In for Pricing
View Details
Gm949 Recombinant Protein (Mouse)
RP138770 100 µg

Gm949 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal C9orf98 Antibody
NBP1-88242 0.1 mL

Rabbit Polyclonal C9orf98 Antibody

Sign In for Pricing
View Details
Nipsnap1 sgRNA CRISPR Lentivector set (Mouse)
K4810001 3x 1.0 µg

Nipsnap1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS545009 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Polystyrene A Sulfonyl Chloride
HA5005600431.25G 25 g

Polystyrene A Sulfonyl Chloride

Sign In for Pricing
View Details