Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA1551 Peptide - C-terminal region

KIAA1551 Peptide - C-terminal region

Product Specifications

UniProt

Q9HCM1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIAA1551 Rabbit Polyclonal Antibody (orb326780) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060639

Preservative

Lyophilized powder

AA Sequence

KEQAPLQVSGIKSTKEDWLKFVATKKRTQKDSQERDNVNSRLSKRSFSAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
BNC470225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-100 1x 100 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF647 conjugate, 0.1mg/mL
BNC470032-500 1x 500 µL

MUC2 (CCP58), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details