Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFAF7 Peptide - C-terminal region

NDUFAF7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MidA

UniProt

Q7L592

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFAF7 Rabbit Polyclonal Antibody (orb587091) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001077415

Preservative

Lyophilized powder

AA Sequence

LGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLMNPKKMGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST2H2BE (H2BFQ, Histone H2B Type 2-E, Histone H2B-GL105, Histone H2B.q, H2B, MGC119802, MGC119804, MGC129733, MGC129734) (APC)
127880-APC 100 µL

HIST2H2BE (H2BFQ, Histone H2B Type 2-E, Histone H2B-GL105, Histone H2B.q, H2B, MGC119802, MGC119804, MGC129733, MGC129734) (APC)

Sign In for Pricing
View Details
ADAM15 Peptide
DF8350-BP 1 mg

ADAM15 Peptide

Sign In for Pricing
View Details
Rabbit Anti-FNDC5 antibody
SL8486R-01 50 µL

Rabbit Anti-FNDC5 antibody

Sign In for Pricing
View Details
Rabbit Anti-FNDC5 antibody
SL8486R-02 100 µL

Rabbit Anti-FNDC5 antibody

Sign In for Pricing
View Details
Speedy/Ringo Recombinant Protein Antigen
NBP2-55183PEP 100 µL

Speedy/Ringo Recombinant Protein Antigen

Sign In for Pricing
View Details
Neural cell Adhesion molecule 1 (NCAM1/CD56) Rabbit ELISA Kit
F2892 96 Tests

Neural cell Adhesion molecule 1 (NCAM1/CD56) Rabbit ELISA Kit

Sign In for Pricing
View Details