Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFAF7 Peptide - C-terminal region

NDUFAF7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MidA

UniProt

Q7L592

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFAF7 Rabbit Polyclonal Antibody (orb587091) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001077415

Preservative

Lyophilized powder

AA Sequence

LGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLMNPKKMGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Absolute Mag™ Carboxyl Magnetic Nanoparticles, Dextran Coated, 130 nm
WHM-G015 10 mL

Absolute Mag™ Carboxyl Magnetic Nanoparticles, Dextran Coated, 130 nm

Sign In for Pricing
View Details
IgG, H&L (HRP)
MBS625237-01 0.5 mg

IgG, H&L (HRP)

Sign In for Pricing
View Details
IgG, H&L (HRP)
MBS625237-02 5x 0.5 mg

IgG, H&L (HRP)

Sign In for Pricing
View Details
CDHR4 Antibody
KC-43338-01 50 μL

CDHR4 Antibody

Sign In for Pricing
View Details
CDHR4 Antibody
KC-43338-02 100 µL

CDHR4 Antibody

Sign In for Pricing
View Details
CDHR4 Antibody
KC-43338-03 1 mL

CDHR4 Antibody

Sign In for Pricing
View Details