Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPATCH2L Peptide - middle region

GPATCH2L Peptide - middle region

Product Specifications

UniProt

Q9NWQ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPATCH2L Rabbit Polyclonal Antibody (orb326790) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060396

Preservative

Lyophilized powder

AA Sequence

SRWKENTPWTSSGHGLCESAENRTFLSKTGRKERMECETDEQKQGSDENM

More Discoveries

Explore Other Products

Browse additional items from our catalog

Foxi1 Rat siRNA Oligo Duplex (Locus ID 287185)
SR508406 1 Kit

Foxi1 Rat siRNA Oligo Duplex (Locus ID 287185)

Sign In for Pricing
View Details
Acyl-CoA-Binding Protein (DBI) Antibody (HRP)
abx107930-01 20 µg

Acyl-CoA-Binding Protein (DBI) Antibody (HRP)

Sign In for Pricing
View Details
Acyl-CoA-Binding Protein (DBI) Antibody (HRP)
abx107930-02 50 µg

Acyl-CoA-Binding Protein (DBI) Antibody (HRP)

Sign In for Pricing
View Details
Acyl-CoA-Binding Protein (DBI) Antibody (HRP)
abx107930-03 100 µg

Acyl-CoA-Binding Protein (DBI) Antibody (HRP)

Sign In for Pricing
View Details
Acyl-CoA-Binding Protein (DBI) Antibody (HRP)
abx107930-04 200 µg

Acyl-CoA-Binding Protein (DBI) Antibody (HRP)

Sign In for Pricing
View Details
Acyl-CoA-Binding Protein (DBI) Antibody (HRP)
abx107930-05 1 mg

Acyl-CoA-Binding Protein (DBI) Antibody (HRP)

Sign In for Pricing
View Details