Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX13B Peptide - N-terminal region

TEX13B Peptide - N-terminal region

Product Specifications

Product Name Alternative

TGC3B, TSGA5

UniProt

Q9BXU2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEX13B Rabbit Polyclonal Antibody (orb587096) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112563

Preservative

Lyophilized powder

AA Sequence

LQGFAKLHRSAALVLASNLTELKEQQEMECNEATFQLQLTETSLAEVQRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMF1-BGLAP Rabbit Monoclonal Antibody [Clone ID: R07-1G3]
TA422001 100 µL

PMF1-BGLAP Rabbit Monoclonal Antibody [Clone ID: R07-1G3]

Sign In for Pricing
View Details
Synaptophysin (SYP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A1]
TA506105AM 100 µL

Synaptophysin (SYP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A1]

Sign In for Pricing
View Details
CD5 (C5/473), 0.2mg/mL
BNUB0473-500 1x 500 µL

CD5 (C5/473), 0.2mg/mL

Sign In for Pricing
View Details
16a,17a-Epoxyprogesterone
TRC-E589580-2.5G 2.5 g

16a,17a-Epoxyprogesterone

Sign In for Pricing
View Details
DLX3 Rabbit Monoclonal Antibody [Clone ID: R03-0C2]
TA421434 100 µL

DLX3 Rabbit Monoclonal Antibody [Clone ID: R03-0C2]

Sign In for Pricing
View Details
NUDT6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10B4]
TA502355AM 100 µL

NUDT6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10B4]

Sign In for Pricing
View Details