Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDNF Peptide - C-terminal region

NDNF Peptide - C-terminal region

Product Specifications

Product Name Alternative

C4orf31

UniProt

Q8TB73

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDNF Rabbit Polyclonal Antibody (orb587129) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078850

Preservative

Lyophilized powder

AA Sequence

NEDQKKREQNQCLGPDIRKKSEKVLCKYFHSQNLQKAVTTETIKGLQPGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Baculoviral IAP Repeat Containing Protein 6 (BIRC6)
TRV-0059672-01 20 µL

Monoclonal Antibody to Baculoviral IAP Repeat Containing Protein 6 (BIRC6)

Sign In for Pricing
View Details
Monoclonal Antibody to Baculoviral IAP Repeat Containing Protein 6 (BIRC6)
TRV-0059672-02 100 µL

Monoclonal Antibody to Baculoviral IAP Repeat Containing Protein 6 (BIRC6)

Sign In for Pricing
View Details
Monoclonal Antibody to Baculoviral IAP Repeat Containing Protein 6 (BIRC6)
TRV-0059672-03 200 µL

Monoclonal Antibody to Baculoviral IAP Repeat Containing Protein 6 (BIRC6)

Sign In for Pricing
View Details
Monoclonal Antibody to Baculoviral IAP Repeat Containing Protein 6 (BIRC6)
TRV-0059672-04 1 mL

Monoclonal Antibody to Baculoviral IAP Repeat Containing Protein 6 (BIRC6)

Sign In for Pricing
View Details
Neuromedin S antibody
70R-51177 100 ul

Neuromedin S antibody

Sign In for Pricing
View Details
BFSP1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
13303124 3x 1.0µg DNA

BFSP1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details