Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC48 Peptide - C-terminal region

CCDC48 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C3orf73, CCDC48

UniProt

Q9HA90

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC48 Rabbit Polyclonal Antibody (orb326811) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079044

Preservative

Lyophilized powder

AA Sequence

LEAELQRYRSEDSQLPTPQLANPEPGDKSNEPEDAGTRDPDPTPEGAWQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAL26 AAV siRNA Pooled Vector
48164161 1.0 µg

TRNAL26 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Spike RBD Antibody, Chimeric mAb, Human IgG1 (AS113) (Omicron Specific)
SPD-M415-100ug 100 µg

Anti-SARS-CoV-2 Spike RBD Antibody, Chimeric mAb, Human IgG1 (AS113) (Omicron Specific)

Sign In for Pricing
View Details
GALNT4 (Polypeptide N-acetylgalactosaminyltransferase 4, Polypeptide GalNAc Transferase 4, GalNAc-T4, pp-GaNTase 4, Protein-UDP Acetylgalactosaminyltransferase 4, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 4) (HRP)
127139-HRP 100 µL

GALNT4 (Polypeptide N-acetylgalactosaminyltransferase 4, Polypeptide GalNAc Transferase 4, GalNAc-T4, pp-GaNTase 4, Protein-UDP Acetylgalactosaminyltransferase 4, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 4) (HRP)

Sign In for Pricing
View Details
Dulcitol-13C6
011009 2.5 mg

Dulcitol-13C6

Sign In for Pricing
View Details
FAM71B Protein Vector (Human) (pPM-C-HA)
20092021 500 ng

FAM71B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
C1QB Rabbit mAb
E60M2640 100 µL

C1QB Rabbit mAb

Sign In for Pricing
View Details