Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC48 Peptide - C-terminal region

CCDC48 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C3orf73, CCDC48

UniProt

Q9HA90

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC48 Rabbit Polyclonal Antibody (orb326811) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079044

Preservative

Lyophilized powder

AA Sequence

LEAELQRYRSEDSQLPTPQLANPEPGDKSNEPEDAGTRDPDPTPEGAWQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUTA Polyclonal Antibody
E-AB-18633-01 20 µL

CUTA Polyclonal Antibody

Sign In for Pricing
View Details
CUTA Polyclonal Antibody
E-AB-18633-02 60 µL

CUTA Polyclonal Antibody

Sign In for Pricing
View Details
CUTA Polyclonal Antibody
E-AB-18633-03 120 µL

CUTA Polyclonal Antibody

Sign In for Pricing
View Details
CUTA Polyclonal Antibody
E-AB-18633-04 200 µL

CUTA Polyclonal Antibody

Sign In for Pricing
View Details
H2-Ob sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3172407 1.0 µg DNA

H2-Ob sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
NOS3 (pS1177) Blocking Peptide
abx063012-01 1 mg

NOS3 (pS1177) Blocking Peptide

Sign In for Pricing
View Details