TCTN2 Peptide - N-terminal region
TCTN2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C12orf38, MKS8, TECT2
UniProt
Q96GX1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TCTN2 Rabbit Polyclonal Antibody (orb587139) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001137322
Preservative
Lyophilized powder
AA Sequence
VIPGAVLEVTVRWKRGLDWCSSNETDSFSESPCILQTLLVSASHNSSCSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740149-500 1x 500 µL
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880525-100 1x 100 µL
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470096-500 1x 500 µL
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details