Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD18 Peptide - N-terminal region

ABHD18 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C4orf29

UniProt

Q0P651

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABHD18 Rabbit Polyclonal Antibody (orb587147) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034806

Preservative

Lyophilized powder

AA Sequence

WRRRTLMARPMIKEARMASLLLENPYYGCRKPKDQVRSSLKNVSDLFVMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Dermal Fibroblast Cell Complete Medium
CM-R086-01 100 mL

Rat Dermal Fibroblast Cell Complete Medium

Sign In for Pricing
View Details
Rat Dermal Fibroblast Cell Complete Medium
CM-R086-02 4x 125 mL

Rat Dermal Fibroblast Cell Complete Medium

Sign In for Pricing
View Details
Recombinant Neurospora crassa NADH-ubiquinone oxidoreductase chain 6 (ndh-6), partial
MBS7056402 Inquire

Recombinant Neurospora crassa NADH-ubiquinone oxidoreductase chain 6 (ndh-6), partial

Sign In for Pricing
View Details
M6A Lentiviral Activation Particles (m2)
sc-433347-LAC-2 200 µL

M6A Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Tau discontinued
336608-01 50 µg

Tau discontinued

Sign In for Pricing
View Details
Tau discontinued
336608-02 100 µg

Tau discontinued

Sign In for Pricing
View Details