Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM121 Peptide - N-terminal region

TMEM121 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hole

UniProt

Q9BTD3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM121 Rabbit Polyclonal Antibody (orb326817) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079544

Preservative

Lyophilized powder

AA Sequence

LTTLVIMGSMAVMDAYLVEQNQGPRKIGVCIIVLVGDVCFLLVLRYVAVW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,6-Dichloro-2-(propylthio)pyrimidin-5-amine
TRC-D435565-1G 1 g

4,6-Dichloro-2-(propylthio)pyrimidin-5-amine

Sign In for Pricing
View Details
Acetylcholinesterase (ACHE) Rabbit Polyclonal Antibody
TA373191 100 µL

Acetylcholinesterase (ACHE) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PSRC1 activation kit by CRISPRa
GA113674 1 Kit

Human PSRC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Bcat1 Mouse Gene Knockout Kit (CRISPR)
KN502085 1 Kit

Bcat1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor®700 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103UM1-01 25 µg

Elab Fluor®700 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Elab Fluor®700 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103UM1-02 100 µg

Elab Fluor®700 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details