FAM220A Peptide - middle region
FAM220A Peptide - middle region
Product Specifications
Product Name Alternative
C7orf70, SIPAR
UniProt
Q7Z4H9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAM220A Rabbit Polyclonal Antibody (orb587161) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001032240
Preservative
Lyophilized powder
AA Sequence
ATPSTAVGLFPAPTECFARVSCSGVEALGRRDWLGGGPRATDGHRGQCPK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940460-500 1x 500 µL
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471081-500 1x 500 µL
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC051429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details