ARHGEF39 Peptide - N-terminal region
ARHGEF39 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RP11-331F9.7
UniProt
Q8N4T4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARHGEF39 Rabbit Polyclonal Antibody (orb326835) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_116207
Preservative
Lyophilized powder
AA Sequence
QEQRARWERKRACTARELLETERRYQEQLGLVATYFLGILKAKGTLRPPE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472848-500 1x 500 µL
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401989-500 1x 500 µL
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042984-100 1x 100 µL
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682554-500 1x 500 µL
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details