Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM222A Peptide - N-terminal region

FAM222A Peptide - N-terminal region

Product Specifications

Product Name Alternative

C12orf34

UniProt

Q5U5X8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAM222A Rabbit Polyclonal Antibody (orb326837) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116218

Preservative

Lyophilized powder

AA Sequence

SRTVNGYDTSGQRYSPYPQHTAGYQGLLAIVKAAVSSSSTAAPAGPAKSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-100 1x 100 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-100 1x 100 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL
BNC880391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-500 1x 500 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-100 1x 100 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details