Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C8orf76 Peptide - C-terminal region

C8orf76 Peptide - C-terminal region

Product Specifications

UniProt

Q96K31

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C8orf76 Rabbit Polyclonal Antibody (orb587166) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116236

Preservative

Lyophilized powder

AA Sequence

FPHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Bnc1 activation kit by CRISPRa
GA200430 1 Kit

Mouse Bnc1 activation kit by CRISPRa

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF488A conjugate, 0.1mg/mL
BNC883257-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LDH1 Human Protein
AR00108PU-N 0.1 KU

LDH1 Human Protein

Sign In for Pricing
View Details
Mouse Dcp1a activation kit by CRISPRa
GA210395 1 Kit

Mouse Dcp1a activation kit by CRISPRa

Sign In for Pricing
View Details
CentiMark PCR Marker (ready-to-use), 5 x 50µg
NM2420 5 x 50μg

CentiMark PCR Marker (ready-to-use), 5 x 50µg

Sign In for Pricing
View Details
JNK1 (MAPK8) (NM_002750) Human Over-expression Lysate
LY400970 100 µg

JNK1 (MAPK8) (NM_002750) Human Over-expression Lysate

Sign In for Pricing
View Details