Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C8orf76 Peptide - C-terminal region

C8orf76 Peptide - C-terminal region

Product Specifications

UniProt

Q96K31

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C8orf76 Rabbit Polyclonal Antibody (orb587166) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116236

Preservative

Lyophilized powder

AA Sequence

FPHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR1 (NM_023110) Human Over-expression Lysate
LY402963 100 µg

FGFR1 (NM_023110) Human Over-expression Lysate

Sign In for Pricing
View Details
Slc18a1 Mouse Gene Knockout Kit (CRISPR)
KN515905 1 Kit

Slc18a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD117 (C117/370), CF640R conjugate, 0.1mg/mL
BNC400370-500 1x 500 µL

CD117 (C117/370), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin Receptor (hPRL Receptor) (rPRLR/742), CF405S conjugate, 0.1mg/mL
BNC043784-500 1x 500 µL

Prolactin Receptor (hPRL Receptor) (rPRLR/742), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
QuantiChrom™ Glyoxalase I Assay Kit
DGLO-100 100 Tests

QuantiChrom™ Glyoxalase I Assay Kit

Sign In for Pricing
View Details
Smpd3 Mouse Gene Knockout Kit (CRISPR)
KN516346 1 Kit

Smpd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details