Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLIP Peptide - middle region

MLIP Peptide - middle region

Product Specifications

Product Name Alternative

C6orf142

UniProt

Q5VWP3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MLIP Rabbit Polyclonal Antibody (orb587176) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612636

Preservative

Lyophilized powder

AA Sequence

HGMAPQQKHGQQYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVSKDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sdccag8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3434508 1.0 µg DNA

Sdccag8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
JMJD6 Antibody
A26667-100UL 100 µL

JMJD6 Antibody

Sign In for Pricing
View Details
KLC1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV682065 1.0 µg DNA

KLC1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Monoclonal FLJ20097 Antibody (monoclonal) (M01), Clone: 2D11
AMM03553G 0.05mg

Monoclonal FLJ20097 Antibody (monoclonal) (M01), Clone: 2D11

Sign In for Pricing
View Details
5- (5-ethyl-4,5,6,7-tetrahydro-1-benzothien-2-yl) -1,3,4-oxadiazole-2-thiol
sc-350166 1 g

5- (5-ethyl-4,5,6,7-tetrahydro-1-benzothien-2-yl) -1,3,4-oxadiazole-2-thiol

Sign In for Pricing
View Details
2,3-DCPE hydrochloride 10mg
A15330-10 10 mg

2,3-DCPE hydrochloride 10mg

Sign In for Pricing
View Details