Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLIP Peptide - middle region

MLIP Peptide - middle region

Product Specifications

Product Name Alternative

C6orf142

UniProt

Q5VWP3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MLIP Rabbit Polyclonal Antibody (orb587176) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612636

Preservative

Lyophilized powder

AA Sequence

HGMAPQQKHGQQYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVSKDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC25B (S353) (CDC25B, CDC25HU2, M-phase inducer phosphatase 2, Dual specificity phosphatase Cdc25B) (FITC) discontinued
033578-FITC 200 µL

CDC25B (S353) (CDC25B, CDC25HU2, M-phase inducer phosphatase 2, Dual specificity phosphatase Cdc25B) (FITC) discontinued

Sign In for Pricing
View Details
BFAR Protein Lysate
OCOA02325-20UG 20 µg

BFAR Protein Lysate

Sign In for Pricing
View Details
Mouse Smooth Muscle Antibody ELISA Kit
MBS043181-01 48 Well

Mouse Smooth Muscle Antibody ELISA Kit

Sign In for Pricing
View Details
Mouse Smooth Muscle Antibody ELISA Kit
MBS043181-02 96 Well

Mouse Smooth Muscle Antibody ELISA Kit

Sign In for Pricing
View Details
Mouse Smooth Muscle Antibody ELISA Kit
MBS043181-03 5x 96 Well

Mouse Smooth Muscle Antibody ELISA Kit

Sign In for Pricing
View Details
Mouse Smooth Muscle Antibody ELISA Kit
MBS043181-04 10x 96 Well

Mouse Smooth Muscle Antibody ELISA Kit

Sign In for Pricing
View Details