STPG1 Peptide - C-terminal region
STPG1 Peptide - C-terminal region
Product Specifications
UniProt
Q5TH74
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with STPG1 Rabbit Polyclonal Antibody (orb587177) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_835223
Preservative
Lyophilized powder
AA Sequence
SCFKSKTNRGLKLTSTGPGPGYYNPSDCTKVPKKTLFPKNPILNFSAQPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-FGF1-Ch-01 96 Tests
Chicken Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit
Sign In for Pricing
View Details RD-FGF1-Ch-02 48 Tests
Chicken Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit
Sign In for Pricing
View Details 
PKSV030118 100 µg
Recombinant AcmNPV Envelope glycoprotein gp64 (His Tag)
Sign In for Pricing
View Details 
BNC942246-500 1x 500 µL
Melanoma Antigen Family A, 4 / MAGEA4 (CPTC-MAGEA4-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details