Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STPG1 Peptide - C-terminal region

STPG1 Peptide - C-terminal region

Product Specifications

UniProt

Q5TH74

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STPG1 Rabbit Polyclonal Antibody (orb587177) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835223

Preservative

Lyophilized powder

AA Sequence

SCFKSKTNRGLKLTSTGPGPGYYNPSDCTKVPKKTLFPKNPILNFSAQPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LDHAL6A activation kit by CRISPRa
GA115996 1 Kit

Human LDHAL6A activation kit by CRISPRa

Sign In for Pricing
View Details
MUSK pTyr755 Rabbit Polyclonal Antibody
AP26453PU-N 100 µL

MUSK pTyr755 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SynaptoGreenTMC3 5x1mg
#70026 5x 1 mg

SynaptoGreenTMC3 5x1mg

Sign In for Pricing
View Details
EIF4E (Ab-209) Antibody
8B7067-AAT 50 µg

EIF4E (Ab-209) Antibody

Sign In for Pricing
View Details
Mammaglobin-A Antibody
KC-3212-01 50 μL

Mammaglobin-A Antibody

Sign In for Pricing
View Details
Mammaglobin-A Antibody
KC-3212-02 100 µL

Mammaglobin-A Antibody

Sign In for Pricing
View Details