Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMAC1 Peptide - C-terminal region

DMAC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TMEM261, C9orf123

UniProt

Q96GE9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMAC1 Rabbit Polyclonal Antibody (orb326848) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_219500

Preservative

Lyophilized powder

AA Sequence

MGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLSIATWGIVVMADPKGKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Leucine Rich alpha 2-Glycoprotein 1 (LRG1) CLIA Kit
abx493271-01 96 Tests

Mouse Leucine Rich alpha 2-Glycoprotein 1 (LRG1) CLIA Kit

Sign In for Pricing
View Details
Mouse Leucine Rich alpha 2-Glycoprotein 1 (LRG1) CLIA Kit
abx493271-02 5x 96 Tests

Mouse Leucine Rich alpha 2-Glycoprotein 1 (LRG1) CLIA Kit

Sign In for Pricing
View Details
Mouse Leucine Rich alpha 2-Glycoprotein 1 (LRG1) CLIA Kit
abx493271-03 10x 96 Tests

Mouse Leucine Rich alpha 2-Glycoprotein 1 (LRG1) CLIA Kit

Sign In for Pricing
View Details
1-Palmitoyl Lysophosphatidic Acid
T37282-01 10 mg

1-Palmitoyl Lysophosphatidic Acid

Sign In for Pricing
View Details
1-Palmitoyl Lysophosphatidic Acid
T37282-02 25 mg

1-Palmitoyl Lysophosphatidic Acid

Sign In for Pricing
View Details
1-Palmitoyl Lysophosphatidic Acid
T37282-03 5 mg

1-Palmitoyl Lysophosphatidic Acid

Sign In for Pricing
View Details