Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMAC1 Peptide - C-terminal region

DMAC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TMEM261, C9orf123

UniProt

Q96GE9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMAC1 Rabbit Polyclonal Antibody (orb326848) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_219500

Preservative

Lyophilized powder

AA Sequence

MGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLSIATWGIVVMADPKGKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDV3 Conjugated Antibody
MBS9454400-01 0.1 mL (Biotin)

CDV3 Conjugated Antibody

Sign In for Pricing
View Details
CDV3 Conjugated Antibody
MBS9454400-02 0.1 mL (AF350)

CDV3 Conjugated Antibody

Sign In for Pricing
View Details
CDV3 Conjugated Antibody
MBS9454400-03 0.1 mL (AF405)

CDV3 Conjugated Antibody

Sign In for Pricing
View Details
CDV3 Conjugated Antibody
MBS9454400-04 0.1 mL (AF488)

CDV3 Conjugated Antibody

Sign In for Pricing
View Details
CDV3 Conjugated Antibody
MBS9454400-05 0.1 mL (AF555)

CDV3 Conjugated Antibody

Sign In for Pricing
View Details
CDV3 Conjugated Antibody
MBS9454400-06 0.1 mL (AF594)

CDV3 Conjugated Antibody

Sign In for Pricing
View Details