Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD40 Peptide - C-terminal region

ANKRD40 Peptide - C-terminal region

Product Specifications

UniProt

Q6AI12

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD40 Rabbit Polyclonal Antibody (orb587183) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443087

Preservative

Lyophilized powder

AA Sequence

AILRTPESTKPGPVCQPPVSQSRSLFSSVPSKPPMSLEPQNGTYAGPAPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TAG-72 Antibody
ANT-36388-100ug 100 µg

Human TAG-72 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal CD300c Antibody (103) [Janelia Fluor 646]
NBP2-89992JF646 0.1 mL

Rabbit Monoclonal CD300c Antibody (103) [Janelia Fluor 646]

Sign In for Pricing
View Details
LOC100360671 3'UTR Luciferase Stable Cell Line
TU207670 1.0 mL

LOC100360671 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ETFA Antibody
E301336 100 µg - 200 µL

ETFA Antibody

Sign In for Pricing
View Details
Roseburia
LBSX-0522-GF49 200 µg

Roseburia

Sign In for Pricing
View Details
ANXA10 Antibody - C-terminal region
OASG00413-100UL 100 µL

ANXA10 Antibody - C-terminal region

Sign In for Pricing
View Details