Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD40 Peptide - C-terminal region

ANKRD40 Peptide - C-terminal region

Product Specifications

UniProt

Q6AI12

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD40 Rabbit Polyclonal Antibody (orb587183) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443087

Preservative

Lyophilized powder

AA Sequence

AILRTPESTKPGPVCQPPVSQSRSLFSSVPSKPPMSLEPQNGTYAGPAPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yipf4 (NM_001009712) Rat Tagged Lenti ORF Clone
RR215680L3 10 µg

Yipf4 (NM_001009712) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal NT5C2 Antibody
NBP3-12213 100 µg

Rabbit Polyclonal NT5C2 Antibody

Sign In for Pricing
View Details
Polar RR Nitrile
11-01-0100 100 g

Polar RR Nitrile

Sign In for Pricing
View Details
CAMKK2 Antibody
orb1557261-01 50 μL

CAMKK2 Antibody

Sign In for Pricing
View Details
CAMKK2 Antibody
orb1557261-02 100 µL

CAMKK2 Antibody

Sign In for Pricing
View Details
CAMKK2 Antibody
orb1557261-03 200 µL

CAMKK2 Antibody

Sign In for Pricing
View Details