Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP23 Peptide - C-terminal region

ATP23 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KUB3, XRCC6BP1

UniProt

Q9Y6H3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP23 Rabbit Polyclonal Antibody (orb326851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_150592

Preservative

Lyophilized powder

AA Sequence

NISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prpsap1 Rabbit Polyclonal Antibody (HRP)
orb2103386 100 µL

Prpsap1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
P21 Waf1/Cip1 (B-2) AC
sc-271532 AC 500 µg/mL - 25% ag

P21 Waf1/Cip1 (B-2) AC

Sign In for Pricing
View Details
Mouse IL-3 R beta Alexa Fluor 647 Antibody (Clone 130705)
FAB5492R-100UG 100 µg

Mouse IL-3 R beta Alexa Fluor 647 Antibody (Clone 130705)

Sign In for Pricing
View Details
SLC25A19 siRNA (Human)
CRJ1790-01 15 nmol

SLC25A19 siRNA (Human)

Sign In for Pricing
View Details
SLC25A19 siRNA (Human)
CRJ1790-02 30 nmol

SLC25A19 siRNA (Human)

Sign In for Pricing
View Details
Rnf39 AAV siRNA Pooled Vector
40310166 1.0 µg

Rnf39 AAV siRNA Pooled Vector

Sign In for Pricing
View Details