Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP23 Peptide - C-terminal region

ATP23 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KUB3, XRCC6BP1

UniProt

Q9Y6H3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP23 Rabbit Polyclonal Antibody (orb326851) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_150592

Preservative

Lyophilized powder

AA Sequence

NISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vanucizumab ELISA Kit
orb2975838 96 Tests

Vanucizumab ELISA Kit

Sign In for Pricing
View Details
SLC22A7 ORF Vector (Human) (pORF)
43964011 1.0 µg DNA

SLC22A7 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
NDUFA4L2 Polyclonal Antibody
ANT-13406-100ug 100 µg

NDUFA4L2 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Plch1 Pre-designed siRNA Set A
SI210618A 1 Each

Rat Plch1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
BBS12 (NM_152618) Human 3' UTR Clone
SC211214 10 µg

BBS12 (NM_152618) Human 3' UTR Clone

Sign In for Pricing
View Details
GUF1 CRISPR/Cas9 KO Plasmid (m)
sc-433051 20 µg

GUF1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details